4.67 Rating by ClearWebStats
callmydoctorr.com is 3 years 8 months 2 weeks old. This website has a #2,987,255 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 240.00 and has a daily earning of $ 1.00. While no active threats were reported recently by users, callmydoctorr.com is SAFE to browse.
Get Custom Widget

Traffic Report of Callmydoctorr

Daily Unique Visitors: 161
Daily Pageviews: 322

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 2,987,255
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View callmydoctorr.com site advisor rating Not Applicable

Where is callmydoctorr.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with callmydoctorr.com

Hosted Country:

callmydoctorr.com hosted country US callmydoctorr.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View callmydoctorr.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: 5 H4 Headings: 6
H5 Headings: 11 H6 Headings: 11
Total IFRAMEs: Not Applicable Total Images: 24
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

callmydoctorr.com favicon - jenniferchemsales.com

View callmydoctorr.com Pagerank   callmydoctorr.com alexa rank Not Applicable   callmydoctorr.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

callmydoctorr.com favicon - shrivishwakarmasafetytraininginstitute.com

View callmydoctorr.com Pagerank   callmydoctorr.com alexa rank Not Applicable   callmydoctorr.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

callmydoctorr.com favicon - theshineenglishacademy.com

View callmydoctorr.com Pagerank   callmydoctorr.com alexa rank Not Applicable   callmydoctorr.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

callmydoctorr.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View callmydoctorr.com Pagerank   callmydoctorr.com alexa rank Not Applicable   callmydoctorr.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

callmydoctorr.com favicon - 247bestpillpharma.com

View callmydoctorr.com Pagerank   callmydoctorr.com alexa rank Not Applicable   callmydoctorr.com website value $ 8.95

HTTP Header Analysis

HTTP/2 200
date: Mon, 17 Aug 2020 18:21:04 GMT
server: Apache
x-ua-compatible: IE=edge
link: <https://callmydoctorr.com/wp-json/>; rel="https://api.w.org/", <https://callmydoctorr.com/wp-json/wp/v2/pages/79>; rel="alternate"; type="application/json", <https://callmydoctorr.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8

Domain Information for callmydoctorr.com

Domain Registrar: PDR LTD. D/B/A PUBLICDOMAINREGISTRY.COM callmydoctorr.com registrar info
Registration Date: 2020-08-13 3 years 8 months 2 weeks ago
Last Modified: 2020-08-13 3 years 8 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net callmydoctorr.com name server information 162.241.148.33 callmydoctorr.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net callmydoctorr.com name server information 162.241.148.33 callmydoctorr.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
callmydoctorr.com A 14400 IP:162.241.148.33
callmydoctorr.com NS 86400 Target:ns2.bh-ht-17.webhostbox.net
callmydoctorr.com NS 86400 Target:ns1.bh-ht-17.webhostbox.net
callmydoctorr.com SOA 86400 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:sampurnraj100.gmail.com
Serial:2020081304
Refresh:86400
Retry:7200
Expire:3600000
callmydoctorr.com MX 14400 Target:mail.callmydoctorr.com
callmydoctorr.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to Callmydoctorr

Sklep triathlonowy - stroje, pianki, akcesoria

callmydoctorr.com favicon - triathlonista.com

Profesjonalny sklep triathlonowy oferuje kompleksowe wyposażenie zawodników i amatorów (pianki neoprenowe, stroje startowe, skarpety, akcesoria rowerowe i inne) a także doradztwo w zakresie sprzętu triathlonowego

View callmydoctorr.com Pagerank   Alexa rank for callmydoctorr.com 2,987,258   website value of callmydoctorr.com $ 240.00

RASP based Web Application Security for Ruby, Python, Java & Node.JS

callmydoctorr.com favicon - immun.io

See how IMMUNIO's fully automated application protection simplifies application security for popular frameworks including Ruby on Rails, Python and Java.

View callmydoctorr.com Pagerank   Alexa rank for callmydoctorr.com 2,987,271   website value of callmydoctorr.com $ 240.00

EvA

callmydoctorr.com favicon - eva-lution.ru

социальная сеть, женский форум.15 вариантов как нарисовать ёлочку.Как аккуратно накрасить ногти лаком.Гороскоп женственности..Гороскоп в известных картинах..Про секс.Какая свадьба?.13 резких замечаний психолога, которых не понять пустому человеку.Свиной рулет с яблоками и клюквой.Интересный узор для вязания шарфа.Пипе Ригате с куриным филе и овощами.

View callmydoctorr.com Pagerank   Alexa rank for callmydoctorr.com 2,987,286   website value of callmydoctorr.com $ 240.00

Prazer Game

callmydoctorr.com favicon - prazergame.com

View callmydoctorr.com Pagerank   Alexa rank for callmydoctorr.com 2,987,287   website value of callmydoctorr.com $ 240.00

Jiji Blog | Only Fresh And Tasty Articles ✮

callmydoctorr.com favicon - jiji-blog.com

Jiji Blog ❤❤❤ All interesting nigerian news and all around the world ❤

View callmydoctorr.com Pagerank   Alexa rank for callmydoctorr.com 2,987,294   website value of callmydoctorr.com $ 240.00

Full WHOIS Lookup for callmydoctorr.com

Domain Name: CALLMYDOCTORR.COM
Registry Domain ID: 2552700612_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: http://www.publicdomainregistry.com
Updated Date: 2020-08-13T07:04:36Z
Creation Date: 2020-08-13T06:55:49Z
Registry Expiry Date: 2021-08-13T06:55:49Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2020-08-17T18:21:01Z